Protein display: Silver-gray brushtail possum (Trichosurus vulpecula) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                             -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                             1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AF027382,IGHA c      (N)PKVSPRLFPLSSFYSET....SDSIVLGCLAY RFFP..EPVD  MTWDYSGSGG....TVRNYPAMLIGD.......AYTQASVLDLPADQC..SNTQAYEC QVQHY....DTSA NLTVPCKA
  AF157617,IGHE c        .TSTAPSVFPLVSGCDPNF...ESLSFLGCLVS GYFP..EPVT  VSWNPEVLDG....IITTFPAAYDSTS.....GLYTTTSQLAISDG.....SSQEFTC SVDHLP..TSTKI EKHVST
  AF157619,IGHG c      (A)SPTAPSVFALAPNCGQGT...SSQVAMACLVS NYFP..EPVT  VTWNSGAISS....GIQTYPSILQSS......GLYTSSSQLTVPADDW...LTKSYIC NVAHKP..TSTKT DKKI
  AF157618,IGHM c      (A)TQAAPNLFSLSSCWSSQMK..DAPVAVGCLAK DFLP..DSID  FSWSYQNRSAVSNTDLKIFPSLMRGS.......TYTATSQVILHANDAFQGEDSYLVC KTRHP....RGDK EVQVPLR
  CH2
  AF027382,IGHA c         CSKTAYVSLSPPSLESLLL..GTGANLTCTLS GLKSS.TGVE  FTWARTPAPASTLSPIQGTAEQDSSG.......KYSVSSVLEICTEEW..IRGDVFSC TVSHP...EIETT TKTIYKPK
  AF157617,IGHE c (G)PTKNGPVIPPTVKLFHSSCDPRGDA.HSTIQLLCLVS GFSP..ARVK  VTWLVDGQEAEN..LFPYTTRPKREGS.....QTFSLQSELNITQGQW..TSLKTYTC QVTHN....GSIY RDNAQKCS
  AF157619,IGHG c     (A)CDVVGPSVFLFPPNPKDTLTL.SRVPKITCVVV DVSDA.SEVQ  ISWYKGENAI....DSPKPTERKLNN......GTFQVVSTLSVAHQEW..LNGVAYTC KVDNKE..LPYPE RKTIFHTK
  AF157618,IGHM c     (D)HIINSPNVTVYIPPSDAFSSSSPRTSKLICQAT NFRP..NKIK  LTWLQEGRPVLS..GISTGQVLPDGS......GTYLLQSSLTINENDW..LSQNTFTC RVEHE....GAQF QKNVSSTCFS
  CH3
  AF027382,IGHA c      (V)TQIPPQVYVLPPSADELAL..NELVTIVCLVR GHSP..QEAL  VQWMNGSEKLPRE.DYITSDPHPEPRG....TNTFIISSILQVSASEW..KAENKYSC VVGHEA.LPLNFT QQTIDRFS...GKPTNVNVSVIMSDVSGTCY
  AF157617,IGHE c     (D)TDPRGISAYLSPPSAFDLYV..SKAPVLTCLVV DLASA.ENVK  VSWTRESGGTV...SPSSPVVKEQYN......GTVTITSTLPVQTDDW..VEGETYTC HLEHPD..LPFPL IRTISKAP
  AF157619,IGHG c      (G)NRKKPDVYVFAPHPDELKQ..KDTVSITCLVK SFFP..KEVV  VEWQCNNNPESED.NYSTTEAMREND.......TFFVYSKLNVKKTKW..QENNHYTC TVLHEA.LPNQTS QRTISASSP..GK
  AF157618,IGHM c     (E)GPELPSEAFAIAPTFASIFV..TKSAKLTCLVT NLPTA.QNPN  ITWTRANGQPL...ETTIKLSLSHLN......GTFSAEGEATVCAEDW..NAGEIFKC TVIHPN..HPVPL KKEIFKQQ
  CH4
  AF147617,IGHE c      (G)KRIAPEVYMFPPSEEEK....GNTVSLTCLIR AFYP..ADIT  VQWLRDNKDDHTG.HHTTTRPHKDHGP....DPSFFLYSRMVVNRSHW..QEGHTFTC RVVHEALPGTRTL DKSLHYST...GN
  AF147618,IGHM c     (G)AVMHAPAVYLLPPAPEELTL..REAATLTCLMR DFSP..ADVF  VQWRHKGQPIPSE.KYVTSSPQQEPQK....AGLYFSHSTLTVSEENW..NAGDSYTC VVVHEA.LPLSVT EKTVDKST...GKPTLVNVSLVLSDASNTCY
  Hinge
  AF027382,IGHA c      (A)VQDPSQC
  AF157619,IGHG c      (E)KISECTCCKCQ
c: cDNA sequence


Created: 01/07/2002
Last updated: Tuesday, 16-Jun-2020 15:27:18 CEST
Author: Christèle Martinez-Jean