Protein display: Mouse TRA, TRB, TRG and TRD C-REGIONs

The TRC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The TRA, TRB, TRG and TRD protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

_____________________________________________________________________________________________________________________________________________________________________________________________

      TR C-GENEs

_____________________________________________________________________________________________________________________________________________________________________________________________

                                 A        AB     B           BC        C      CD      D          DE           E      EF   F                FG                    G  

                           -------------->   ---------->             ------>       ------->              ----------->  ------->                           ---------------->

                           1       10   15  16  20 23 26   30    36 39 41 45      77     84             85  89     96 97    104    110              115 118  121    130
                   87654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|.123456654321...|.. ..|.........|....
EX1
M64239    ,TRAC     (X)IQNPEPAVYQLKDPR........SQDSTLCLFT DFDS...QIN  VPKTMES.......GTFITDKTVLDMKAM.DSKSNGAIAWSNQT..........SFTC QDIFKE.............TNATYP SS
M26053    ,TRBC1  (E)DLRNVTPPKVSLFEPSKAEIAN..KQKATLVCLAR GFFP..DHVE  LSWWVNGKEVHS..GVSTDPQAYKESN.....YSYCLSSRLRVSATFWH.NPRNHFRC QVQFHGLSEEDKWPEGSPKPVTQNI SAEAWGRA
M26057    ,TRBC2  (E)DLRNVTPPKVSLFEPSKAEIAN..KQKATLVCLAR GFFP..DHVE  LSWWVNGKEVHS..GVSTDPQAYKESN.....YSYCLSSRLRVSATFWH.NPRNHFRC QVQFHGLSEEDKWPEGSPKPVTQNI SAEAWGRA
M23381    ,TRDC    (X)SQPPAKPSVFIMKNG...........TNVACLVK DFYP..KEVT  ISLRSSKKI.....VEFDPAIVISPS......GKYSAVKLGQYGD.......SNSVTC SVQHN..............SETVHS TDFEPYANSF
M13340    ,TRGC1 (D)KRLDADISPKPTIFLPSVAETNL..HKTGTYLCLLE KFFP..DVIR  VYWKEKDGNTIL..DSQEGDTLKTND.......TYMKFSWLTVPER....AMGKEHRC IVKHENN............KGGADQ EIFFPSIKK
M12834    ,TRGC2 (D)KRLDADISPKPTIFLPSVAETNL..HKTGTYLCLLE KFFP..DVIR  VYWKEKNGNTIL..DSQEGDTLKTKG.......TYMKFSWLTVPER....AMGKEHSC IVKHENN............KGGADQ EIFFPSIKK
M12837    ,TRGC3 (D)KKLDADISPKPTIFLPSVAETNL..HKTGTYLCVLE KFFP..DVIR  VYWKEKKGNTIL..DSQEGDMLKTND.......TYMKFSWLTVPER....SMGKEHRC IVKHENN............KGGADQ EIFFPTIKK
AF021335  ,TRGC4 (D)KRTDSDFSPKPTIFLPSAAETNL..HKAGTYLCLLE KFFP..EVIR  VYWKEKDGEKIL..ESQEGNTIKTND.......RYMKFSWLTVTED....SMAKEHSC IVKHENN............KRGVDQ EILFPPIGK

				CONNECTING-REGION 
                        [EX2A]                    [EX2] 
M64239    ,TRAC                                    (D)VPCDATLTEKSFET	 
M26054    ,TRBC1                                     (D)CGITS									
M26058    ,TRBC2                                     (D)CGITS 					                                 
L36133    ,TRDC                      (N)NEKLPEPENDTQISEPCYGPR  							
M13341    ,TRGC1                             (V)AVSTKPTTCWQDKN								
M12835    ,TRGC2                                  (V)ATTCWQDKN								
M12838    ,TRGC3                             (V)AVSTKPTTCWQDKN 								
L02340    ,TRGC4 (A)FTTINVNPRDSVLRHEN        (V)NNATDLEDCMKGRK [EX2B] (L02341)    

                                    TRANSMEMBRANE-REGION   CYTOPLASMIC-REGION
                                    [EX3]                       [EX4]
M64239   ,TRAC   (D)MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS*
M26055   ,TRBC1  (A)SYQQGVLSATILYEILLGKATLYAVLVSTLVVMAM  VKRKNS  (M26056)
M26059   ,TRBC2  (A)SYHQGVLSATILYEILLGKATLYAVLVSGLVLMAM  VKKKNS  (M26060)
L36134   ,TRDC    (V)TVHTEKVNMMSLTVLGLRLLFAKTIAINFLLTVKLFF*
M13342   ,TRGC1 (D)VLQLQFTITSAYYTYLLLLLKSVIYLAIISFSLLRRTSVCGNEKKS
M12836   ,TRGC2 (D)VLQFQFTSTSAYYTYLLLLLKSVIYLAIISFSLLRRTSVCGNEKKS
M12839   ,TRGC3 (D)VLQLQFTITSAYYTYLLLLLKSVIYLAIISFSLLRRTSVCCNEKKS
AF021335 ,TRGC4 (D)MLQLQVTTTYAFYTYLILFFKSMVHLAFVVFCLFRRAAMSCDDQRS



Created: Tuesday, 16-Jun-2020 15:27:16 CEST
Authors: Christelle Jean and Delphine Guiraudou