Protein display: Bovine (Bos taurus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.
_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                           A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                                    -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                    1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                             7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AF109167,IGHA               (E)SETSPSIFPLSLGNNDP....AGQVVIGCLVQ GFFPS.APLS  VTWNQNGDSV....SVRNFPAVLAGS.......LYTMSSQLTLPASLC..PKGQSVTC QVQHL...SKASK TVAVPCIIQ
  U63640  ,IGHE               (A)SIQAPSIYPLRLCCTE.....EARVRLGCLVK DYLP..GSVT  VTWDTVPLDG....STLTFPSIQMASS.....SLYITTSQLTISGE.....QSKEFTC RVLHP...ETIQL NKTST
  X16701  ,IGHG1 (1)          (A)STTAPKVYPLSSCCGDKS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVLQSS......GLYSLSSMVTVPGST....SGQTFTC NVAHPA..SSTKV DKAV
  M36946  ,IGHG2 (2)          (A)STTAPKVYPLSSCCGDKS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVLQSS......GLYSLSSMVTVPGST....SGQTFTC NVAHPA..SSTKV DKAV
  U63638  ,IGHG3 (3)          (A)STTAPKVYPLASSCGDTS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVRQSS......GLYSLSSMVTVPASSS...ETQTFTC NVAHPA..SSTKV DKAVTARRPVPTTPKTTIPPGKPTTP
  U63637  ,IGHM               (E)GESHPKVFPLVSCVSSPSD..ESTVALGCLAR DFVP..NSVS  FSWKFNNSTVSSE.RFWTFPEVLRDG.......LWSASSQVVLPSSSAFQGPDDYLVC EVQHPK.GGKTVG TVRVIAT
  CH2
  AF109167,IGHA                   NCEPSLSVQPPALEDLLL..GSNASLTCTLS GLKSA.EGAS  FTWNPTGGKT....AVQGSPKRDSCG.......CYSVSSVLPGCADPW..NSGQTFSC SVTHPE..SKSSL TATIKKDL
  U63640  ,IGHE            (E)CVKNFSDPSVKLFFSSCNPNGDT.QTTIHLLCRIS AYTP..GKIK  VTWLVDGLQSEE..LYARSGPEIQEG......NLTSTYSEVNITQGQW..VSEKTYTC RVNYY....GYNF ESHAHRCT
  X16701  ,IGHG1            (P)PELPGGPSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGHDDPEVK  FSWFVDDVEVN...TATTKPREEQFN......STYRVVSALRIQHQDW..TGGKEFKC KVHNEG..LPAPI VRTISRTK
  M36946  ,IGHG2              (C)CVREPSVFIFPPKPKDTLMI.TGTPEVTCVVV NVGHDNPEVQ  FSWFVDDVEVH...TARTKPREEQFN......STYRVVSALPIQHQDW..TGGKEFKC KVNIKG..LSASI VRIISRSK
  U63638  ,IGHG3              (E)PLGGLSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGQDDPEVQ  FSWFVDDVEVH...TARTKPREEQFN......STYRVVSALRIQHQDW..LQGKEFKC KVNNKG..LPAPI VRTISRTK
  U63637  ,IGHM              (K)AEVLSPVVSVFVPPRNSLSGDGNSKSSLICQAT DFSP..KQIS  LSWFRDGKRIVS..GISEGQVETVQSS....PITFRAYSMLTITERDW..LSQNAYTC QVEHN....KETF QKNVSSSCDV
  CH3
  AF109167,IGHA               (G)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..KEVL  VRWLQGNQELPRE.KYLTWGPLPEAGQS...VTTFAVTSVLRVDAEVW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMSEVDGVCY
  U63640  ,IGHE              (A)ESEPRVSAYLSPPTPLELYV..NKSPKITCLVV DLANE.KNLS  LTWSRANGKPV...HAGPPEIKRQFN......GTVTVTSTLPVDVTDW..VEGETYYC KVSHRD..LPTDI QRSISKDV
  X16701  ,IGHG1              (G)PAREPQVYVLAPPQEELS...KSTVSLTCMVT SFYP..DYIA  VEWQRNGQPESED.KYGTTPPQLDAD......SSYFLYSKLRVDRNSW..QEGDTYTC VVMHEA.LHNHYT QKSTSKSA...GK
  M36946  ,IGHG2              (G)PAREPQVYVLDPPKEELS...KSTVSVTCMVI GFYP..EDVD  VEWQRDRQTESED.KYRTTPPQLDAD......RSYFLYSKLRVDRNSW..QRGDTYTC VVMHEA.LHNHYM QKSTSKSA...GK
  U63638  ,IGHG3              (G)QAREPQVYVLAPPREELS...KSTLSLTCLIT GFYP..EEID  VEWQRNGQPESED.KYHTTAPQLDAD......GSYFLYSKLRVNKSSW..QEGDHYTC AVMHEA.LRNHYK EKSISRSP...GK
  U63637  ,IGHM               (A)PPSPIGVFTIPPSFADIFL..TKSAKLSCLVT NLASY.DGLN  ISWSRQNAKAL...ETHTYFERHLND.......TFSARGEASVCSEDW..ESGEEFTC TVAHSD..LPFPE KNAVSKPK
  CH4
  U63640  ,IGHE               (G)KRLAPKDYVFLADGKELEN..EEELTLTCMIQ NFFP..RDIF  VRWLHNKELMGAD.QHTTTQPHRDDNN....TPAFFAYSRLAVPRANW..KRGDEFTS QVIHEALPRTRTL EKSVFINS...GK
  U63637  ,IGHM              (D)VAMKPPSVYLLPPTREQLSL..RESASVTCLVK AFAP..ADVF  VQWLQRGEPVTKS.KYVTSARAPEPQDP...SVVYFVHSILTVAEEDW..SKGETYTC VV.HEA.LPHMVT ERTVDKST...GKPTLYNVSLVLSDTASTCY
  Hinge
  AF109167,IGHA               (D)SSSCCVP
  X16701  ,IGHG1              (D)PTCKPSPCDCCP
  M36946  ,IGHG2              (G)VSSDCSKPNNQH
  U63638  ,IGHG3              (K)SEVEKTPCQCSKCP
                                                    M1                        M2
  U63637  ,IGHM                    (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK  VK
                                 CONNECTING-REGION| TRANSMEMBRANE-REGION      | CYTOPLASMIC-REGION

IMGT notes:
(1) IGHG1*03 (cDNA) has a polymorphic amino acid INSERTION between codon 99 and 100 in the IMGT unique numbering for C-DOMAIN
(2) IGHG2*02 (cDNA) has a polymorphic amino acid INSERTION between codon 99 and 100 in the IMGT unique numbering for C-DOMAIN
(3) Twenty-two additional amino acids are encoded by the 3' end of CH1. As this region is rich in proline (7 aa out of 22), it is likely to be part of the structural hinge [1].

Reference:
[1] Rabbani , H. et al., Immunogenetics, 46, 326-331 (1997).


Created: 01/07/2002
Last updated: Tuesday, 16-Jun-2020 15:27:07 CEST
Author: Christèle Martinez-Jean